PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 318aa    MW: 35993.3 Da    PI: 5.7331
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1266genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
      Gh_D08G1266 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding53.26.6e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T+eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
      Gh_D08G1266  67 RGRFTPEEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466894.12E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.4E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-251568IPR009057Homeodomain-like
CDDcd001674.36E-111761No hitNo description
PROSITE profilePS5129425.71262116IPR017930Myb domain
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2569116IPR009057Homeodomain-like
CDDcd001671.55E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPEEEKLIIS LHGVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPS  120
APPTSTAPPP STTEHSQINY GSNQLELVNQ ELMTGAIPNH QETLFSSPAP LFIFDTTPLD  180
GAQVHQHGNN VRGELFHEPA NLNTESSWNL NQHQVQAFPP STSFTVGMDT NNYLPPLVEN  240
MENMVVPVEV QSCSIEEEGE MTLECLQRQQ QELNEWVESQ QCSNFLFWDT LEGQLGGEAL  300
PPTSSNMGTT LSSFPTSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141167108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.60701e-125boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4302161e-122KF430216.1 Gossypium hirsutum MYB103 protein (MYB103) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012474915.10.0PREDICTED: transcription factor MYB46 isoform X1
SwissprotQ8LPH66e-66MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A0D2MY000.0A0A0D2MY00_G
STRINGVIT_02s0025g00320.t011e-170(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87602539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.11e-97myb domain protein 103